DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and LIPI

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001289927.1 Gene:LIPI / 149998 HGNCID:18821 Length:460 Species:Homo sapiens


Alignment Length:317 Identity:91/317 - (28%)
Similarity:134/317 - (42%) Gaps:62/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ETGFFLNTRRVQENAQPIEAEVEALVRSSFYAADPT---------VVTIPRWLGNISSPEIPAVV 76
            ||...:.||.....|:|:..:..:| ..:|.....|         |.:||.||.|.        |
Human    42 ETILMMYTRNNLNCAEPLFEQNNSL-NVNFNTQKKTVWLIHGYRPVGSIPLWLQNF--------V 97

  Fly    77 SARLQQQDSNIISVDLSEA------NDETEIIDSVA-SLVIVLHN--QFDMPLDRILVVGFAEGA 132
            ...|.::|.|:|.||.|..      |...:....|| ||.:.:.|  :....||....:|.:.||
Human    98 RILLNEEDMNVIVVDWSRGATTFIYNRAVKNTRKVAVSLSVHIKNLLKHGASLDNFHFIGVSLGA 162

  Fly   133 HLAGGVAAKVQQDLGRQLSQITALDPSSGAELDHK-----LSQADAEFVEVVHTNAGGEGTWERL 192
            |::|.|.......|||    ||.||| :|.....|     |...||:||:|:|:::.|.|..|.|
Human   163 HISGFVGKIFHGQLGR----ITGLDP-AGPRFSRKPPYSRLDYTDAKFVDVIHSDSNGLGIQEPL 222

  Fly   193 GHVDYYPNGGQTQPGCTTD--------SCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC- 248
            ||:|:|||||..||||...        .|:|:||..|.........:|:|..|.|.:....|.| 
Human   223 GHIDFYPNGGNKQPGCPKSIFSGIQFIKCNHQRAVHLFMASLETNCNFISFPCRSYKDYKTSLCV 287

  Fly   249 ------RWSTHKMG----------QKQEEEQPASGIYFLETRQSSPFSRGAYFISFL 289
                  ..|..::|          :::.|.:|.....||:|..:.||....:.:|.:
Human   288 DCDCFKEKSCPRLGYQAKLFKGVLKERMEGRPLRTTVFLDTSGTYPFCTYYFVLSII 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 85/297 (29%)
LIPINP_001289927.1 Pancreat_lipase_like 41..309 CDD:238363 83/280 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145232
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.