DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:325 Identity:88/325 - (27%)
Similarity:142/325 - (43%) Gaps:77/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TGFFLNTRRVQENAQPIEAEVEALVRSSFYAADP-TVVTIPRW---------LGNISSPEIPAVV 76
            |.|.|.|.......|.|.|...:.:::|::..|. |.:.|..|         :.|:         
Human    54 TRFLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDGKWQRDMCNV--------- 109

  Fly    77 SARLQQQDSNIISVDLSEANDETEIIDSVASL----------VIVLHNQFDMPLDRILVVGFAEG 131
              .||.:|.|.|::|.  .|...|.|.:|.:|          :.||..:|:....::.::|.:.|
Human   110 --LLQLEDINCINLDW--INGSREYIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLG 170

  Fly   132 AHLAGGVAAKVQQDLGRQLSQITALDPSS----GAELDHKLSQADAEFVEVVHTNAG------GE 186
            |||||...::: ..|||    ||.|||:.    ....:.:|..:||.||:|:||||.      |.
Human   171 AHLAGEAGSRI-PGLGR----ITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGV 230

  Fly   187 GTWERLGHVDYYPNGGQTQPGC--------------------TTDSCSHERAFELLAEMWSPEND 231
            ||.:..||:|:|||||:..|||                    :...|:|.|:::..||.....:.
Human   231 GTIDACGHLDFYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDA 295

  Fly   232 FVSARCGSVETLSASSCRWSTHK----MGQKQE----EEQPASGI-YFLETRQSSPFSRGAYFIS 287
            |::..|.|..:..|.:|.:.:.:    ||...:    :....:|. |||.|...|||:|..:.:|
Human   296 FIAYPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLSPFARWRHKLS 360

  Fly   288  287
            Human   361  360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 81/308 (26%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 84/315 (27%)
Pancreat_lipase_like 52..348 CDD:238363 83/311 (27%)
PLAT_PL 355..467 CDD:238857 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.