DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and pnliprp3

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_031761690.1 Gene:pnliprp3 / 100487975 XenbaseID:XB-GENE-6250474 Length:420 Species:Xenopus tropicalis


Alignment Length:326 Identity:70/326 - (21%)
Similarity:129/326 - (39%) Gaps:81/326 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TGFFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSN 86
            |.:||.||...:..|.|.:. .::..|:|.....|...|..::..........:....|:.:|.|
 Frog     8 TRYFLVTRENPDYFQEIISH-SSVSTSNFKPNRKTRFIIHGFVNTAERGWQMEMCQVMLEVEDVN 71

  Fly    87 IISVD--------LSEANDETEIIDS-VASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKV 142
            ...:|        .::|.:...::.: :||.:..|...:|.....|.::|.:.|||:||....:|
 Frog    72 CFCIDWRGGSFTLYTQAANNIRVVGAELASFIGYLSKNYDYSPSMIHIIGHSLGAHVAGEAGKRV 136

  Fly   143 QQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAG------GEGTWERLGHVDY 197
            .     .:::|:.|||:    .....:.:|...||:||:.:||:..      |.|..:.:||:|:
 Frog   137 P-----GIARISGLDPAGPLFQNTPPEVRLDPTDADFVDAIHTDTSPLIPKIGLGMAQSVGHLDF 196

  Fly   198 YPNGGQTQPGCTTD-------------------SCSHERAFELLAEMWSPENDFVSARCGSVETL 243
            :||||||.|||.::                   :|:|.|:::...|.....:.||:....:.|..
 Frog   197 FPNGGQTMPGCGSNIITRLLDIEELWGGADNYLACNHLRSYKYYTESIRTPDAFVAFPSDTYEAF 261

  Fly   244 --------SASSCRWSTHKMGQKQEEEQPASGIY--------------FLETRQSSPFSRGAYFI 286
                    .::.|               |..|.|              :|.|...||::|..|.:
 Frog   262 MKGTGFPCPSTGC---------------PLMGYYAGFYGRGTLSGLPLYLNTGDVSPYARWRYKV 311

  Fly   287 S 287
            :
 Frog   312 T 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 64/309 (21%)
pnliprp3XP_031761690.1 Lipase 2..304 CDD:395099 67/316 (21%)
PLAT 307..417 CDD:412108 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.