DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and LOC100331214

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:308 Identity:83/308 - (26%)
Similarity:135/308 - (43%) Gaps:60/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LNTR-RVQENAQP-------IEAEVEALVRSSFYAADPTVVTIPRW-LGNISSPEIPAVVSARL- 80
            ||.: .::..:||       :..:.|.|...:|.....|::.|..| :..:....:..:|:|.. 
Zfish    51 LNVKFSLRNPSQPDDDVCYIVRGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAALYN 115

  Fly    81 QQQDSNIISVD-LSEAND-------ETEIIDSVASLVI-VLHNQFDMPLDRILVVGFAEGAHLAG 136
            :::|:|:|.|| |..|.|       .|:::.....|.| .:....::||:.:.::|::.|||:||
Zfish   116 REKDANVIVVDWLDTAQDHYVVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAG 180

  Fly   137 GVAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGE-----GTWERL 192
            ...:.....:||    ||.|||:    .|.....:||..||.||:|:||...|.     |..:.:
Zfish   181 FAGSHTTNKIGR----ITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPV 241

  Fly   193 GHVDYYPNGGQTQPGCTTDS------------------CSHERAFELLAEMWSPENDFVSAR--- 236
            ||||.|||||..||||....                  |.|||:..|..:  |..|:..:.|   
Zfish   242 GHVDIYPNGGSFQPGCNLRGALEKMASYGIFAINNAIRCEHERSIHLFID--SLLNEEAAGRAYS 304

  Fly   237 CGSVETLSASSC----RWSTHKMGQKQEEEQPASGI-YFLETRQSSPF 279
            |||.:......|    :...:.:|....:.:.|..: .|.:||.|.||
Zfish   305 CGSNDMFDRGVCLQCRKNGCNTVGYDISKVRKARSVKMFTKTRGSMPF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 78/301 (26%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 83/308 (27%)
Pancreat_lipase_like 51..347 CDD:238363 78/301 (26%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.