DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and lipib

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:291 Identity:79/291 - (27%)
Similarity:123/291 - (42%) Gaps:72/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FYAADPTVVTI---------PRWLGNISSPEIPAVVSARLQQQDSNIISVDLSEANDETEIIDSV 105
            |....||...|         |.|:.:|        |.....|:|.||:.||.:........:.:|
Zfish    69 FNVTRPTTFVIHGYRPTGAPPIWINHI--------VHLLAAQKDMNILVVDWNRGAANLNYLTAV 125

  Fly   106 ASL---------VIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPS-- 159
            |:.         .|....:....||.|.::|.:.|||:||.:.|.    ||.::.:||.|||:  
Zfish   126 ANTRGTALNITRFIESMEKEGASLDSIHLIGVSLGAHVAGFIGAM----LGGRVGRITGLDPAGP 186

  Fly   160 --SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQPGC--TTDS------CS 214
              :....:.:|...||:||:|:||:....|.....||:|:|.|||..||||  |..|      |.
Zfish   187 MFASVSPEERLDPTDAQFVDVLHTDMNSFGLRGTHGHIDFYANGGLDQPGCPKTIFSGKSYFVCD 251

  Fly   215 HERA-FELLAEM----------WSPENDFVSARCGSVETLSASSC--------RW--STHKMGQK 258
            |:|: |..|..:          .|..:||:|.:|...||...:||        :|  :..::||.
Zfish   252 HQRSVFLYLCSLNRTCSLTGYPCSSYSDFLSGQCLQCETFKPASCPVLGYDLSQWRDTLLRLGQT 316

  Fly   259 QEEEQPASGIYFLETRQSSPFSRGAYFISFL 289
            :        .|| .|....|:|:.:|.:..:
Zfish   317 R--------AYF-STTAELPYSKTSYRVDLV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 75/274 (27%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 76/279 (27%)
Pancreat_lipase_like 40..324 CDD:238363 76/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.