DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD7 and JMJD7-PLA2G4B

DIOPT Version :9

Sequence 1:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_005081.1 Gene:JMJD7-PLA2G4B / 8681 HGNCID:34449 Length:1012 Species:Homo sapiens


Alignment Length:272 Identity:104/272 - (38%)
Similarity:147/272 - (54%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERALDVLLQE-------AEELCIGSSVVELDRIPTALEFCREFYSKNQPVVIRKAL-NWPAIGKW 61
            |.||:.:..|       |.|||:..:|..||:.||.|.|.|::...|:|.:||.|| :|||:.||
Human     3 EAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQHWPALQKW 67

  Fly    62 TPKYLIEALGDRSVDVAITPNGYADGLATQNGQEYFVLPLETKMKLSEVV----RRLDDPTGAVH 122
            :..|....:|...|.||:||:||||.:.    .:.|::|.|.::.||.|:    .|...|  .|.
Human    68 SLPYFRATVGSTEVSVAVTPDGYADAVR----GDRFMMPAERRLPLSFVLDVLEGRAQHP--GVL 126

  Fly   123 YIQKQNSNLSVDLPELAADLRVSDLDFAQQSFNKPPDAVNFWLGDERAVTSMHKDPYENVYCVIS 187
            |:|||.|||..:||:|..||. |.:.:|.::..|.|||||||||:..||||:|||.|||:|||:|
Human   127 YVQKQCSNLPSELPQLLPDLE-SHVPWASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVS 190

  Fly   188 GHKDFVLIPPHQLSCVPRGIYPTGVYKTSDSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDLAKYP 252
            |.|.|:..||.....:|..:|....|:.::.|.|.:.   |||..::                 .
Human   191 GEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVV---DEEAMEK-----------------A 235

  Fly   253 EYARAKPLKVRV 264
            |.:|...|.|||
Human   236 EVSRTCLLTVRV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 91/237 (38%)
JMJD7-PLA2G4BNP_005081.1 Cupin_8 38..>223 CDD:290351 80/191 (42%)
C2_cPLA2 242..361 CDD:176001 4/6 (67%)
cPLA2_Grp-IVB-IVD-IVE-IVF 474..999 CDD:132840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.