DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD7 and HIF1AN

DIOPT Version :9

Sequence 1:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_011538242.1 Gene:HIF1AN / 55662 HGNCID:17113 Length:369 Species:Homo sapiens


Alignment Length:303 Identity:82/303 - (27%)
Similarity:120/303 - (39%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QPVVIRKA-LNWPAIGKWTPKYLIEAL--GDRSVDVAITPNG-YADGLATQNGQEYFVLPLETKM 105
            :|||:... |.:||: ||..:||.|.:  ||.||..|.|... |.|.....|.|.:.......:|
Human    80 EPVVLTDTNLVYPAL-KWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEM 143

  Fly   106 KLSEVVRRLDDPTGAVHYIQKQNSNLSVDLPELAADL--RVSDLDFAQQSFN--KPPDAVNFW-- 164
            |..|.|.:|.|       ||::.....:.|.:...|.  |...:||...::|  ........|  
Human   144 KFHEFVEKLQD-------IQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQ 201

  Fly   165 -------LGDERAVTSMHKDPYENVYCVISGHKDFVLIPPHQLSCVPRGIYPTGVYKTSDSGQFY 222
                   :|.|..||..|.|..:|.:..|.|:|..:|.||.|..|    :||..|:...|     
Human   202 LTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFEC----LYPYPVHHPCD----- 257

  Fly   223 IEPLRDEEGSDQFTEWVSVDPLSPDLAKYPEYARAKPLKVRVHAGDILYLPNYWFHHVS---QSH 284
                |..:          ||..:||..::|.:......:..|..||:||:|.||:||:.   ...
Human   258 ----RQSQ----------VDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGG 308

  Fly   285 KCIAVNFWYD-------LDY----DSRYCYYRMLEQMTSARSG 316
            ..|.|||||.       ::|    ..:....|.:|:|.....|
Human   309 ITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 78/283 (28%)
HIF1ANXP_011538242.1 Cupin_8 80..317 CDD:290351 75/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.