DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD7 and hspbap1

DIOPT Version :9

Sequence 1:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005167885.1 Gene:hspbap1 / 445320 ZFINID:ZDB-GENE-040808-38 Length:456 Species:Danio rerio


Alignment Length:323 Identity:85/323 - (26%)
Similarity:128/323 - (39%) Gaps:79/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LCIGSSVV--------ELDRIPTALEFCREFYSKNQPVV-IRKALNWPAIGKWTPKYLIEAL--- 70
            :|:.:.::        |..||...|:         :|.| :....:|||: .||.::|...|   
Zfish     1 MCVNAKIMSSKPFTPEEARRIVQVLQ---------KPAVFLNMTTDWPAL-HWTVEHLSACLTKR 55

  Fly    71 -----GDRSVDVA---ITPNGYADGLA------TQNGQEYFVLP-LETKMKLSEVVRRLDDPTGA 120
                 |.||.|:|   .|...|.:...      |.|..|..|.| |:...|  |.....|     
Zfish    56 IRFRVGKRSEDMAPLFETECSYVEATIKEFLSWTANDGEPLVGPFLDYHCK--EFWAYAD----- 113

  Fly   121 VHYIQKQNSNLSVDLPELAADLRVSDLDFAQQSFNKPPDAVNFWLGDERAVTSMHKDPYE-NVYC 184
                .|..:.|..|.|.:..|:..||..|..:.....    ..|:|.:.|.|..|.|.|. |:..
Zfish   114 ----YKYIAQLFQDKPAMFQDVVWSDFGFPGRDGRDS----TLWIGTQCANTPCHLDSYGCNLVF 170

  Fly   185 VISGHKDFVLIPPHQLSCVPRGIYPTGVYKTSDSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDLA 249
            .|.|.|.:.|.||...:|    :|||.|               ..|.|..|:.   |:.:.|||.
Zfish   171 QIQGRKRWHLFPPDDTAC----LYPTRV---------------PYEESSVFSH---VNVIRPDLK 213

  Fly   250 KYPEYARAKPLKVRVHAGDILYLPNYWFHHV-SQSHKCIAVNFWYDLDYDSRYCYYRMLEQMT 311
            |:|.|.||:...|.:..|.:|::|.:|:|:| |.....::||.|.::|.|..   .|:.|.:|
Zfish   214 KFPAYGRARLYTVTLQPGQVLFVPRHWWHYVESVDPVTVSVNSWIEMDMDDE---ARVAEALT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 77/285 (27%)
hspbap1XP_005167885.1 Cupin_8 16..264 CDD:290351 80/294 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.