DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD7 and hif1an

DIOPT Version :9

Sequence 1:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_988915.1 Gene:hif1an / 394511 XenbaseID:XB-GENE-966944 Length:352 Species:Xenopus tropicalis


Alignment Length:351 Identity:90/351 - (25%)
Similarity:130/351 - (37%) Gaps:86/351 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EAEELCIGSSVVEL----------DRIPTALEFCREFYSKNQPVV------IRKALNWPAIGKWT 62
            |||..|.|.|..:|          .|:........|...|.:|||      :..||      ||.
 Frog    22 EAELRCPGWSESQLRSYQFQTRQIPRLQHGDPRAEELIDKEEPVVLTDTNLVHTAL------KWD 80

  Fly    63 PKYLIEALGDRSVDVAITPNG----YADGLATQNGQEYFVLPLETKMKLSEVVRRLDDPTGAVHY 123
            ..||.|.:|:....| .:.|.    |.|.....|.:.:.......:||..|.|.:|.|       
 Frog    81 LDYLEENIGNGDFSV-YSANSHKFLYYDEKKMVNFKNFKPKSSREEMKFPEFVNKLKD------- 137

  Fly   124 IQKQNSNLSVDLPELAAD-----LRVSDLDFAQQSFNKPPDAVNFW---------LGDERAVTSM 174
            ||::.|:..:.|.:...|     :.|..|.|.....|| ..|.:.|         :|.|..||..
 Frog   138 IQERESDERLYLQQTLNDTVGRKIVVDFLGFNWNWINK-QQAKHGWGQLTSNLLLIGMEGNVTPA 201

  Fly   175 HKDPYENVYCVISGHKDFVLIPPHQLSCVPRGIYPTGVYKTSDSGQFYIEPLRDEEGSDQFTEWV 239
            |.|..:|.:..|.|:|..:|.||.|..|    :||..|:...|         |..:         
 Frog   202 HYDEQQNFFAQIKGYKRCILFPPEQFEC----LYPYPVHHPCD---------RQSQ--------- 244

  Fly   240 SVDPLSPDLAKYPEYARAKPLKVRVHAGDILYLPNYWFHHVS---QSHKCIAVNFWYD------- 294
             ||..:||..::|.:......:..|..||:||:|.||:||:.   .....|.|||||.       
 Frog   245 -VDFENPDFERFPNFRNVLGYETVVGPGDVLYIPMYWWHHIESLMDGGITITVNFWYKGAPTPKR 308

  Fly   295 LDY----DSRYCYYRMLEQMTSARSG 316
            ::|    ..:....|.:|:|.....|
 Frog   309 IEYPLKAHQKVAIMRNIEKMLGEALG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 78/302 (26%)
hif1anNP_988915.1 Cupin_8 56..300 CDD:372651 75/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8739
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5083
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto102553
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.