DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD7 and Hif1an

DIOPT Version :9

Sequence 1:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001107221.1 Gene:Hif1an / 309434 RGDID:1308281 Length:349 Species:Rattus norvegicus


Alignment Length:309 Identity:82/309 - (26%)
Similarity:120/309 - (38%) Gaps:62/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EFYSKNQPVVIRKA-LNWPAIGKWTPKYLIEAL--GDRSVDVAITPNG-YADGLATQNGQEYFVL 99
            |.....:|||:... |.:||: ||..:||.|.:  ||.||..|.|... |.|.....|.|.:...
  Rat    54 ELIENEEPVVLTDTNLVYPAL-KWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPR 117

  Fly   100 PLETKMKLSEVVRRLDDPTGAVHYIQKQNSNLSVDLPELAADL--RVSDLDFAQQSFN--KPPDA 160
            ....::|..|.|.:|       ..||::.....:.|.:...|.  |...:||...::|  .....
  Rat   118 SNREEIKFHEFVEKL-------QAIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQG 175

  Fly   161 VNFW---------LGDERAVTSMHKDPYENVYCVISGHKDFVLIPPHQLSCVPRGIYPTGVYKTS 216
            ...|         :|.|..||..|.|..:|.:..|.|||..:|.||.|..|    :||..|:...
  Rat   176 KRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGHKRCILFPPDQFEC----LYPYPVHHPC 236

  Fly   217 DSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDLAKYPEYARAKPLKVRVHAGDILYLPNYWFHHVS 281
            |         |..:          ||..:||..::|.:......:..|..||:||:|.||:||:.
  Rat   237 D---------RQSQ----------VDFDNPDYERFPNFRNVVGYETVVGPGDVLYIPMYWWHHIE 282

  Fly   282 ---QSHKCIAVNFWYD-------LDY----DSRYCYYRMLEQMTSARSG 316
               .....|.|||||.       ::|    ..:....|.:|:|.....|
  Rat   283 SLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 78/289 (27%)
Hif1anNP_001107221.1 Cupin_8 53..297 CDD:290351 75/273 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.