DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD7 and Tyw5

DIOPT Version :9

Sequence 1:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001163944.1 Gene:Tyw5 / 301419 RGDID:1311269 Length:315 Species:Rattus norvegicus


Alignment Length:283 Identity:64/283 - (22%)
Similarity:110/283 - (38%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EFCREFYSKNQPVVIRKALNWPAIGKWTPKYLIEALGDRSVDVAITPNGYADGLATQNGQEYFVL 99
            :|....|.:.:|:|:..........|||..||.:..|.:.|.:.:......|.::  ....|..|
  Rat    18 QFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQVGGTKEVKIHVAAVAQMDFIS--KNFVYRTL 80

  Fly   100 PLETKMKLSEVVRRLDDPTGAVHYIQKQNSNLSVDLPELAADLRVSDLDFAQQSFNKPPDAVNF- 163
            |      .:::|:|..:.|....:|.:.....   |..|..|.|....|..|| |....:.:.| 
  Rat    81 P------FNKLVQRAAEETHKEFFISQDERYY---LRSLGEDPRKDIADIRQQ-FPSLGEDITFP 135

  Fly   164 -WLGDERAVTSM------------HKDPYENVYCVISGHKDFVLIPPHQLSCVPRGIYPTGVYKT 215
             :..:|:..:|:            |.|..:|....::|.|...|..|.                 
  Rat   136 MFFREEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFSPR----------------- 183

  Fly   216 SDSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDLAKYPEYARAKPLKVRVHAGDILYLPNYWFHHV 280
             |:...|:        |...:|.:::|  ||||.|||.:.:|:..:..:.|||:|::|..|||:|
  Rat   184 -DAQYLYL--------SGSKSEVLNID--SPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNV 237

  Fly   281 SQSHKCIAVNFWYDLDYDSRYCY 303
            ......:.||.:  |.:....||
  Rat   238 VSEEFGVGVNVF--LKHLPSECY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 62/276 (22%)
Tyw5NP_001163944.1 Cupin_8 17..264 CDD:290351 64/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.