DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD7 and Hspbap1

DIOPT Version :9

Sequence 1:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_599246.2 Gene:Hspbap1 / 171460 RGDID:620870 Length:479 Species:Rattus norvegicus


Alignment Length:310 Identity:69/310 - (22%)
Similarity:124/310 - (40%) Gaps:66/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CIGSSVVEL---------DRI-PTALEFCRE-FYSKNQPVVI-RKALNWPAIGKWTPKYLIEALG 71
            |.|||...|         :|: |...|..:| ..|..||.:. ....:||: ..||.|:|.:.|.
  Rat     5 CEGSSPQTLGERTMGEEGERVKPFTPEKAKEVIMSLQQPAIFCNMVFDWPS-RHWTAKHLSKVLE 68

  Fly    72 DRSVDVAI------------TPNGYADGLATQNGQEYFVLPLETKMKLSEVVRRLDDPTGAVHYI 124
            .:.:...:            |...|.|...    :|:.....: :.::|...::.|......:..
  Rat    69 GKQIRFRMGLRSTGTVPQFETECSYVDATL----EEFLAWNCD-QSRISGPFKKYDHSKFWAYAD 128

  Fly   125 QKQNSNLSVDLPELAADLRVSDLDF----AQQSFNKPPDAVNFWLGDERAVTSMHKDPYE-NVYC 184
            .|....|..|..::..::..||..|    .|:|        ..|:|...|.|..|.|.|. |:..
  Rat   129 YKYFVTLFEDKTDVFQEVMWSDFGFPGRNGQES--------TLWIGSLGAHTPCHLDSYGCNLVF 185

  Fly   185 VISGHKDFVLIPPHQLSCVPRGIYPTGVYKTSDSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDLA 249
            .:.|.|.:.|.||.....    :|||.:               ..|.|..|::   ::.::|||.
  Rat   186 QVQGRKRWHLFPPEDTPF----LYPTRI---------------PYEESSVFSK---INVVNPDLK 228

  Fly   250 KYPEYARAKPLKVRVHAGDILYLPNYWFHHV-SQSHKCIAVNFWYDLDYD 298
            ::|::.:|:...|.:..|.:|::|.:|:|:| |.....:::|.|.:|:.|
  Rat   229 RFPQFQKARRHMVTLSPGQVLFVPRHWWHYVESLDPVTVSINSWIELEED 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 61/284 (21%)
Hspbap1NP_599246.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 5/19 (26%)
Cupin_8 37..272 CDD:404504 57/270 (21%)
Interaction with HSPB1. /evidence=ECO:0000269|PubMed:10751411 88..208 29/136 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.