DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD7 and TYW5

DIOPT Version :9

Sequence 1:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001034782.1 Gene:TYW5 / 129450 HGNCID:26754 Length:315 Species:Homo sapiens


Alignment Length:293 Identity:68/293 - (23%)
Similarity:114/293 - (38%) Gaps:76/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EFCREFYSKNQPVVIRKALNWPAIGKWTPKYLIEALGDRSVDVAITPNGYADGL----------- 88
            :|.:..|.:.:|:|:......|...|||..||.:..|.:.|.:.:......|.:           
Human    18 QFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPF 82

  Fly    89 -------ATQNGQEYFVLPLETKMKLSEVVRRL-DDPTGAVHYIQKQNSNLSVDLPELAADLRVS 145
                   |.:..:|:||...|     ...:|.| :||...|..|:||       .|.|..|::..
Human    83 DQLVQRAAEEKHKEFFVSEDE-----KYYLRSLGEDPRKDVADIRKQ-------FPLLKGDIKFP 135

  Fly   146 DL----DFAQQSFNKPPDAVNFWLGDERAVTSMHKDPYENVYCVISGHKDFVLIPPHQLSCVPRG 206
            :.    .|....|......:..|         .|.|..:|:...::|.|..||..|.        
Human   136 EFFKEEQFFSSVFRISSPGLQLW---------THYDVMDNLLIQVTGKKRVVLFSPR-------- 183

  Fly   207 IYPTGVYKTSDSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDLAKYPEYARAKPLKVRVHAGDILY 271
                      |:...|::..:        :|.:::|  :|||||||.:::|:..:..:.|||:|:
Human   184 ----------DAQYLYLKGTK--------SEVLNID--NPDLAKYPLFSKARRYECSLEAGDVLF 228

  Fly   272 LPNYWFHHVSQSHKCIAVN-FWYDLDYDSRYCY 303
            :|..|||:|......:.|| ||..|..:   ||
Human   229 IPALWFHNVISEEFGVGVNIFWKHLPSE---CY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 66/286 (23%)
TYW5NP_001034782.1 Cupin_8 17..255 CDD:404504 66/285 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.