DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG42397

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:145 Identity:40/145 - (27%)
Similarity:59/145 - (40%) Gaps:16/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KDLDVSGTTDSTLETDSTTSGLEYGLITGNLSICGNVADNVFLPFVGDCNRYYLCRSGQAIELQC 86
            :|.::..|||.:...:.||..|...|....|  |.:  :::||| ..||..||.|..|:.|...|
  Fly    25 EDTNIKLTTDESTTVEDTTEVLVTTLPPPVL--CAD--EDLFLP-APDCREYYQCLYGEGILKIC 84

  Fly    87 E----WPYEFNA---NTQSCVHPGDADCLPT---CEAFNFSTFSYQRTCTRYVLCYYGKPVLRQC 141
            .    |..|.|.   ::|.|....:....|:   | |.......|...||:::.|.|.......|
  Fly    85 PDGLYWDRELNVCAWDSQHCADDKNETTTPSTLNC-ASGLPFLPYIPDCTKFIQCVYNIGFKLSC 148

  Fly   142 QDGLQYNSATDRCDF 156
            ..||.:|.....||:
  Fly   149 PSGLYWNQPLQSCDY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 16/49 (33%)
CBM_14 111..161 CDD:279884 13/46 (28%)
CBM_14 178..222 CDD:279884
CBM_14 246..295 CDD:279884
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 14/46 (30%)
ChtBD2 125..163 CDD:214696 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.