DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG17147

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:293 Identity:62/293 - (21%)
Similarity:112/293 - (38%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DVSGT--TDSTLETDSTTSGLEYGLITGNLSICGNVADNVFLPFVGD---CNRYYLCRSGQAIEL 84
            |.:||  |..:.::.:.:.|.....:..:...|||..:.:...:|.|   |::|:.|.:|..:..
  Fly    55 DGNGTVLTCPSNQSFNPSKGSCVDTLANSNKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPLAG 119

  Fly    85 QCEWPYEFNANTQSCVHPGDADCLPT---CEAFNFST-FSYQRTCTRYVLC-YYGKPVLRQCQDG 144
            .|.....|:..:|||::..|:.|:..   ||....:| |..::.|..|..| ..|....:.|...
  Fly   120 MCPVGQHFDERSQSCLYGVDSMCVDVNNICELVAENTKFRNEKDCAYYYECDKTGNHASKSCTVT 184

  Fly   145 LQYNSATDRCDFPQNVDCVES---ECSIYS------NAYHLRYVPSKVSCQKYFIC------GNG 194
            .:.....|    .::.:|||:   ||:.:|      ::..:.:...:.:|:.||:|      .:.
  Fly   185 SKKREYFD----VESGNCVEANKVECTAHSKENVCTSSTTMTFKSDQATCRGYFVCKALYPVADL 245

  Fly   195 IPREQTCTAGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHESR 259
            .|....|..|..|......|..|:...|                   |...|...|. ..|..|.
  Fly   246 DPLWTQCPEGYFFDEDRQLCANPTTVVC-------------------THNRCDGRGT-MLVTSSS 290

  Fly   260 RDAYYY--CVDGHGLVLD-CSAGLWYDPTVQEC 289
            .:.:.|  |||...:..: |....::|.||:.|
  Fly   291 NNCHNYIRCVDNKEVTEETCHWDHFFDETVEAC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 12/45 (27%)
CBM_14 111..161 CDD:279884 10/51 (20%)
CBM_14 178..222 CDD:279884 10/49 (20%)
CBM_14 246..295 CDD:279884 13/47 (28%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 5/21 (24%)
ChtBD2 89..136 CDD:214696 12/46 (26%)
CBM_14 278..332 CDD:279884 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27026
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.