DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG17145

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:90/239 - (37%) Gaps:48/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YFICI--FCGVFGARPKDLDVSGTTDSTL---ETDSTTSGLEYGLITGNLSICGNVADNVFLPFV 67
            |:.|.  ...::|..|::...:.||....   |:|.|||..||         |..|.:.|....:
  Fly   107 YYYCADEETALYGTCPQETHFNATTQMCSRQHESDCTTSTFEY---------CSIVKNGVNFDNL 162

  Fly    68 GDCNRYYLCRSGQAIELQCEWPYEFNANTQSCVHPGDADC----LPT--C----EAFNFSTFSYQ 122
            ..||.|::|..|...:..|...| :.|:|..||.....||    |||  |    :.:.....:.:
  Fly   163 QGCNMYHVCEKGVLKDKTCSKTY-YQASTGECVSKALVDCDAHPLPTDVCGKASKPYENKFVADE 226

  Fly   123 RTCTRYVLCYYGK-------PVLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSNAYHLRYVP 180
            .||..|..|...|       ||..||.....:::::..|..|.:|.|....|...:.::   .|.
  Fly   227 ATCRGYFYCAKQKDGTPDPNPVWNQCPQDRFFDASSQMCITPSSVYCSHDRCDGRTASF---VVS 288

  Fly   181 SKVSCQKYFICGNGI-------------PREQTCTAGLHFSTKC 211
            :...|:.|..|.:|:             .::..||..:...|.|
  Fly   289 ATKGCRNYLSCSDGVTVSERSCGNYFFDDQQGACTPSVQTYTAC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 11/42 (26%)
CBM_14 111..161 CDD:279884 12/60 (20%)
CBM_14 178..222 CDD:279884 9/47 (19%)
CBM_14 246..295 CDD:279884
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 7/34 (21%)
CBM_14 278..327 CDD:279884 8/51 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.