DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG6933

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster


Alignment Length:276 Identity:62/276 - (22%)
Similarity:93/276 - (33%) Gaps:97/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVIWYFICIFCGVFGARPKDLDVSGTT---DSTLETDST---------------------TSGLE 44
            ||:.:..|....||.|:....|.:.||   .|.:||.|.                     |..:.
  Fly    67 EVVAWGTCPNGLVFNAQAGSCDYANTTVCSTSAVETCSNVKSPMYVANPLNCTEYAYCDGTGQIS 131

  Fly    45 YG-LITGNL-----------------SICGNVADNVFLPFVGDCNRYYLCRSGQAIELQCEW--- 88
            || ..||.:                 :||..:..|:|:.....|..|..|.:|.....:|..   
  Fly   132 YGDCGTGGVYSASSTKCIWGPACPQDTICRFMLSNIFVGDPNQCGNYINCVNGYGTSEKCSSTAN 196

  Fly    89 PYEFNANTQSC--VHP--------GDADCL-------PTC--EAF--------NFSTFSYQR--- 123
            || :|..|.:|  .:|        |::|..       ..|  |||        |..:..|:.   
  Fly   197 PY-YNKATGNCQSTNPCTGEDSNSGNSDQFTVGQTNATACDEEAFKAADPLTVNGESVDYRYVSD 260

  Fly   124 --TCTRYVLC-------YYGKPVLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSNAYHLRYV 179
              ||..|..|       |:     .||..|.|:|:.  :|..|.:..|..:.|...:|.:     
  Fly   261 GVTCYGYYYCAAVNATGYW-----NQCPTGTQFNAG--KCVSPASFVCTHNRCGNVNNPF----- 313

  Fly   180 PSKVSCQKYFICGNGI 195
            .:...|:.|.||.:||
  Fly   314 MADEGCKNYTICSSGI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 13/55 (24%)
CBM_14 111..161 CDD:279884 18/71 (25%)
CBM_14 178..222 CDD:279884 6/18 (33%)
CBM_14 246..295 CDD:279884
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.