DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG10154

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster


Alignment Length:299 Identity:133/299 - (44%)
Similarity:178/299 - (59%) Gaps:39/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GARPKDLDVSGTTDSTLETDSTTSGLEYGLITGNLSICGNVADNVFLPFVGDCNRYYLCRS---- 78
            |...:|.|:....::|                 .:::||||||.|:||:||:|::|..|.:    
  Fly    38 GLNVQDKDIYDMYENT-----------------QINVCGNVADGVYLPYVGNCSKYIECENNTIK 85

  Fly    79 --GQAIEL------------QCEWPYEFNANTQSCVHPGDADCLPTCEAFNFSTFSYQRTCTRYV 129
              |..::|            .||..|:  ...|.|.:..:..||||||:|..|:|.|..|||:||
  Fly    86 EVGSCLDLAKDNPDICDPNKSCELGYD--PVLQVCTYMEEVQCLPTCESFRLSSFCYDNTCTKYV 148

  Fly   130 LCYYGKPVLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSNAYHLRYVPSKVSCQKYFICGNG 194
            ||||||||||||.||||||:||||||||:.||||.::||.......:.|:.||.||.||::|.||
  Fly   149 LCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSATFQPEDIIYLGSKASCSKYYVCSNG 213

  Fly   195 IPREQTCTAGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGI-CPPSGVHFYVHES 258
            .|.||.|..||.::..|.|||.....:|.|.||.|.:...|| :|:....| ||..|.||:.|:|
  Fly   214 HPWEQQCAPGLAYNPSCKCCDFAKNVNCTIDAVARNILPYSR-TPLRRADIKCPLMGTHFFPHKS 277

  Fly   259 RRDAYYYCVDGHGLVLDCSAGLWYDPTVQECREPQNVGM 297
            |||||||||:|.|:.|||:.||:|||.|::||.|:.||:
  Fly   278 RRDAYYYCVEGRGVTLDCTPGLYYDPKVEDCRRPEFVGV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 14/60 (23%)
CBM_14 111..161 CDD:279884 37/49 (76%)
CBM_14 178..222 CDD:279884 20/43 (47%)
CBM_14 246..295 CDD:279884 30/48 (63%)
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 37/49 (76%)
CBM_14 197..239 CDD:279884 20/41 (49%)
ChtBD2 263..311 CDD:214696 30/47 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466376
Domainoid 1 1.000 57 1.000 Domainoid score I17982
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I7014
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27026
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 1 1.000 - - FOG0012676
OrthoInspector 1 1.000 - - mtm9695
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.