DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG14125

DIOPT Version :10

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001261731.1 Gene:CG14125 / 39359 FlyBaseID:FBgn0036232 Length:263 Species:Drosophila melanogaster


Alignment Length:106 Identity:23/106 - (21%)
Similarity:35/106 - (33%) Gaps:17/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 IPREQTCTAGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPS---------- 249
            ||..:|...|...||:      ....:..||..|.:........|.:......|:          
  Fly   159 IPAGETTNEGTSDSTE------EPTGEPSIPTHEPEESSGDPSDPTSATTQTIPNVDANASCRAH 217

  Fly   250 -GVHFYVHESRRDAYYYCVDGHGLVLDCSAGLWYDPTVQEC 289
             ||.|..|......|.:|....|.:.||.:.|:::...|.|
  Fly   218 QGVQFLPHPYDCHLYIHCDGDIGFIKDCPSDLYWNSVNQTC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:426342
CBM_14 111..161 CDD:426342
CBM_14 178..222 CDD:426342 6/26 (23%)
ChtBD2 244..292 CDD:214696 13/57 (23%)
CG14125NP_001261731.1 LGT <80..206 CDD:469786 10/52 (19%)
ChtBD2 217..259 CDD:214696 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.