DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG11570

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:283 Identity:62/283 - (21%)
Similarity:96/283 - (33%) Gaps:103/283 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GEVIWYF-ICIFCGVFGARPKDLDVSGTTDSTLETDSTTSGLEYGLITGNLSICGNVAD---NVF 63
            |.|:.|. :..|..:...:..:..||..||.:::                   |....|   ||.
  Fly     4 GSVVIYLGLLAFIAIVDCQENNNLVSIVTDHSIQ-------------------CPPFDDPNHNVM 49

  Fly    64 LPFVGDCNRYYLCRSGQAIELQCEWPYEFNANTQSCVHPGDADCLPTCEAFN------FSTFSYQ 122
            ||:..||::||:|:.|:|.|.||.....::..|..|.:...::|.....:.|      ||  :|.
  Fly    50 LPYPNDCSKYYVCQKGRAYEQQCPLNLFWSQMTYRCDYKEYSNCNTYIPSPNHDVEVIFS--AYP 112

  Fly   123 RTCTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQNVDCVESEC-------------------- 167
            ..|.|    :|...:|| |:..||::|...||..||..||..|..                    
  Fly   113 GDCRR----FYETRILR-CEQNLQWSSVYQRCVVPQYGDCQNSPVTVPPVVPFTPLPTYPPVPTV 172

  Fly   168 --------------------------------SIYSNAYHLRYVPSKVSCQKYFICG-------- 192
                                            |:.:|:....|:|...||:|:..||        
  Fly   173 PATVIPYDPMPTAGTPPPITPMESLPLPIDVQSLCNNSPPNAYIPYPGSCKKFIHCGPTATILSC 237

  Fly   193 ----NGIPREQTCTAGLHFSTKC 211
                |..|.:..||.   :|..|
  Fly   238 AGSSNWNPAQHACTT---YSNGC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 14/42 (33%)
CBM_14 111..161 CDD:279884 17/55 (31%)
CBM_14 178..222 CDD:279884 13/46 (28%)
CBM_14 246..295 CDD:279884
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.