DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG7252

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster


Alignment Length:375 Identity:74/375 - (19%)
Similarity:120/375 - (32%) Gaps:126/375 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KDLDVSGTT------DSTLETDSTTS---------------GLEYGLITGNLSICGNVADNVFLP 65
            :|.|...||      |||..||:||.               .:.......:.:.|.|.....::.
  Fly   121 EDCDPDTTTSATEPSDSTEPTDATTDFDDPNNSSNTTPSSPSVVPSYCKSSRTDCVNQKTGTYID 185

  Fly    66 FVGDCNRYYLCRSGQAIELQCEWPYEFNANTQSCVHPGDADCLPTC------EAFNFSTFSYQRT 124
            ..|.|.|:..|.:|.|.|.||.....||.....|.:..:.||.||.      |..:.:|.|.|..
  Fly   186 MPGICVRFIQCNNGCAEEFQCPSGLYFNTAIDDCDYWWNVDCTPTADGSTEIEGPSGTTCSSQGE 250

  Fly   125 C--------------TRYVLCYYGKPVLRQCQDGLQ----------------------------- 146
            |              ..:.:|....|:...|.:||:                             
  Fly   251 CAGKRDGYMIADPNSNGFFVCQCQCPIAMPCSEGLKFNETAQVCDWIKDTKSAIGSSAVQCYGDL 315

  Fly   147 -YNSATDRCDFPQN----VDCVESECSIYSNAYHLRYVPSKVSCQKYFICGNGIPREQTCTAGLH 206
             ||:..|:||:|:|    |:| .:..::..|.......|.:..|..::.|......||.|...|.
  Fly   316 VYNATLDQCDYPENYVPKVEC-NTTSTVCQNQPEGELFPVEGKCNMFYKCNFNCAVEQYCPNNLV 379

  Fly   207 FSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGICP------------PSGV-------- 251
            ::        |:..:|:.|      |..          :||            |||:        
  Fly   380 YN--------PNTEECEYP------QDY----------VCPWEYTPPSGPNAGPSGIACESNGRC 420

  Fly   252 ------HFYVHESRRDAYYYCVDGHGLVLDCSAGLWYDPTVQECREPQNV 295
                  .:....:....|..|.....:.::|:.||::|.::|.|.....|
  Fly   421 MGQREGTYLKSTTNCSNYVVCQCECEVEMECADGLYWDESLQTCNYKNQV 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 12/42 (29%)
CBM_14 111..161 CDD:279884 17/103 (17%)
CBM_14 178..222 CDD:279884 8/43 (19%)
CBM_14 246..295 CDD:279884 13/74 (18%)
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 14/50 (28%)
CBM_14 251..296 CDD:279884 6/44 (14%)
CBM_14 343..394 CDD:279884 12/74 (16%)
CBM_14 420..471 CDD:279884 9/51 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.