DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG5897

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:178 Identity:47/178 - (26%)
Similarity:62/178 - (34%) Gaps:37/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SICGNVADNVFLPFVGD---CNRYYLCRSGQAIELQCEWPYEFNANTQSC-------VHPGDADC 107
            :||.::.|.   .||||   |..||.|.:|....|.|.....||..|.:|       ....|.|.
  Fly   146 NICSHMKDG---SFVGDPKSCQIYYKCHNGFGTMLNCSVGRYFNRKTGNCQSWMPHYCSKDDEDN 207

  Fly   108 L--PTCEAFNFSTFSYQR------------TCTRYVLCY----YGKPVLRQCQDGLQYNSATDRC 154
            :  |.....|..:..|||            ||..|..|.    .||  ...|..||.:...:.||
  Fly   208 ILTPPSTDHNICSKYYQRDRDGVQLLPDLMTCYGYYSCTSQFDVGK--WSSCPWGLHFEWWSQRC 270

  Fly   155 DFPQNVDCVESECSIYSNAYHLRYVPSKVSCQKYFIC-GNGIPREQTC 201
            ..|::..|....|   :|...|........|:::.|| .|.....|.|
  Fly   271 GSPKDNSCSYDRC---ANRNQLMVATINTGCREFTICQDNRSKSSQKC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 16/52 (31%)
CBM_14 111..161 CDD:279884 16/65 (25%)
CBM_14 178..222 CDD:279884 6/25 (24%)
CBM_14 246..295 CDD:279884
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.