DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG33986

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:244 Identity:61/244 - (25%)
Similarity:94/244 - (38%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ICGNVADNVFLPFVGDCNRYYLC-RSGQAIELQCEWPYEFNANTQSCVHPGDADCLPTCEAFNFS 117
            ||.|.....|:....||:.:||| .:|.|:...|.....||:.::.|....:..|....:.....
  Fly    40 ICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKCRNETDPIETP 104

  Fly   118 TFSYQRTCTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSNAYHLRYVPSK 182
            .|....                  .||...|..||...:...:  ||.:    .::..:.||.|.
  Fly   105 PFDGGN------------------GDGDPNNMVTDAATYCSTL--VEQQ----QSSDRIVYVGSS 145

  Fly   183 VSCQKYFICGNGIPREQTCTAGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGI-- 245
            .||:||:||..|....|.|::.||::.....||||.::.|.:...|......:...|.....|  
  Fly   146 SSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISS 210

  Fly   246 ----CPPSGVHFYVHESRRDAYYYCVDGHGLVLDCSAGLWYDPTVQECR 290
                ||..|.|.|.|..|.:.:.|||.||..:..|....::|...:.|:
  Fly   211 DLIHCPAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 12/43 (28%)
CBM_14 111..161 CDD:279884 6/49 (12%)
CBM_14 178..222 CDD:279884 18/43 (42%)
CBM_14 246..295 CDD:279884 15/45 (33%)
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 14/50 (28%)
CBM_14 141..185 CDD:279884 18/43 (42%)
ChtBD2 213..261 CDD:214696 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.