DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG4835

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:362 Identity:79/362 - (21%)
Similarity:119/362 - (32%) Gaps:106/362 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PKDLDVSGTT-----DSTLETDSTTSGLEYGLITGNLSICGNVADNVFLPFVGDCNRYYLCRSGQ 80
            |..|...|:|     .:|.|..:||.||...:...:   |.:..|.....::|:|:.|.:|:..|
  Fly   357 PTTLPSDGSTTEIHSSTTEEIVTTTDGLPSDVDPND---CKDEKDGTIFAYIGNCSEYLICKDNQ 418

  Fly    81 AIELQCEWPYEFNANTQSCVHPGDADCL---------------------PTCEAFNFST------ 118
            .....|.....||.:...|..|.|..||                     ||......:|      
  Fly   419 VQMGHCPPNTLFNPDLLVCDEPDDVVCLGDRTTTPIPTTIPTTTTEKTTPTTTTTTVATTLGPDQ 483

  Fly   119 ----------FSYQRTCTRYVLCY-YGKPVLRQCQDGLQYNSATDRCD--------FPQNVDCVE 164
                      |||...|::|.||. .|:..|..|..|..::.:|.:|.        .|..|....
  Fly   484 LCDGQELGASFSYPDDCSKYYLCLGGGQWTLAPCIYGSYFDPSTGQCGPDVAPDACKPSQVTTTT 548

  Fly   165 SECSIYSNAYHLRYVPSKV-------------------------------SCQKYFICGNGIPRE 198
            :..:..:........|...                               :|.||.:|.:.||..
  Fly   549 TTTTTETTTTERNTTPKSTATTTERTTTTVAPKTGICGGRNENENIAYPNNCTKYIVCVSPIPIA 613

  Fly   199 QTCTAGLHFSTKCD-CCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDA 262
            ..|..|..||:|.: |.|...:|||:      ..|..:.|.|    |...|.........|.||.
  Fly   614 FFCPDGTFFSSKLEKCIDDWDESDCE------GDQSTTTLEP----GYTRPPPEPTMCTNSSRDT 668

  Fly   263 YYY---------CVDGHGLVLD-CSAGLWYDPTVQEC 289
            :.|         |||.:..::| |:.|.:|||..::|
  Fly   669 FPYPDNCQWFIRCVDDYIYMMDVCNCGEYYDPITEKC 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 11/42 (26%)
CBM_14 111..161 CDD:279884 15/74 (20%)
CBM_14 178..222 CDD:279884 15/75 (20%)
CBM_14 246..295 CDD:279884 15/54 (28%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 13/50 (26%)
CBM_14 485..539 CDD:279884 13/53 (25%)
CBM_14 585..638 CDD:279884 14/52 (27%)
CBM_14 661..714 CDD:279884 14/45 (31%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.