DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG13806

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:212 Identity:49/212 - (23%)
Similarity:77/212 - (36%) Gaps:54/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ITGNLSICGNVADNVFLPFVGDCNRYYLC----RSGQAIELQCEWPYEFNANTQSC-VHPGDADC 107
            |.||.. |  .:..:| |...||.:|::|    .:..|..:.|.....|:|.|..| :...|:.|
  Fly    98 IEGNFQ-C--TSQGIF-PDPYDCQKYHMCYFVGATLVAAAVDCGNDKAFDATTGQCTLTLTDSVC 158

  Fly   108 L---------------PT-------CEAFNFSTFSYQRTCTRYVLCYYGKPVLRQCQDGLQY--- 147
            |               ||       |:    ||.:.....|  ::.|   |.|.:|.||..:   
  Fly   159 LQRQYYCPNAGHVAAWPTNPNIFYVCK----STVNQNLNDT--IVIY---PSLHRCNDGETFVDY 214

  Fly   148 ------NSATDRCDFPQNV--DCVESECSIYSN-AYHLRYVPSKVSCQKYFICG--NGIPREQTC 201
                  |......|.|..:  |..:.:.|:..| ..|:..:.....|:||:.|.  ||..|...|
  Fly   215 VCRSGSNVLPPSTDDPSVIIEDPNDDDFSVLPNTCQHVGLMADGNDCRKYYYCSALNGTLRHMDC 279

  Fly   202 TAGLHFSTKCDCCDIPS 218
            ..|.::..:...|.:.|
  Fly   280 PNGTYYRPELSSCVLGS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 13/47 (28%)
CBM_14 111..161 CDD:279884 13/60 (22%)
CBM_14 178..222 CDD:279884 11/43 (26%)
CBM_14 246..295 CDD:279884
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 13/53 (25%)
ChtBD2 247..293 CDD:214696 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.