DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and obst-E

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:214 Identity:57/214 - (26%)
Similarity:84/214 - (39%) Gaps:57/214 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GD-CNRYYLCRSGQAIELQCEWPYEFNANTQSCVHPGDADCLP--TCE----------------A 113
            || |:.|..|:.|..:|..|.....|:..|::   .|:....|  ||:                .
  Fly    35 GDQCDSYTECQDGTPVEKLCPDGLLFHQRTK
A---TGECTYAPYSTCKERARLQPANGTEECPRQ 96

  Fly   114 FNFSTFSYQRTCTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSNAY---- 174
            |.|........|..|..|.:|...|.:|.:||.:|..|.:||:|   |.||| |:  :.||    
  Fly    97 FGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWP---DLVES-CN--AEAYLGFN 155

  Fly   175 ---------------------HLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTKCDCCDIPS 218
                                 .|||.....:|:|||:|.||.||...|...|.|:::...||..:
  Fly   156 CPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKYLAFNSQTKLCDFYN 220

  Fly   219 KSDCQIPAVERKVQQLSRL 237
            |    :|.....:::..||
  Fly   221 K----VPECYALLKEKQRL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 11/38 (29%)
CBM_14 111..161 CDD:279884 16/65 (25%)
CBM_14 178..222 CDD:279884 16/43 (37%)
CBM_14 246..295 CDD:279884
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 9/29 (31%)
CBM_14 95..146 CDD:307643 19/54 (35%)
CBM_14 180..225 CDD:307643 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.