DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and CG31077

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:346 Identity:73/346 - (21%)
Similarity:109/346 - (31%) Gaps:109/346 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GEVIWYFICIFCGVFGARPKDLDVSGTTDSTLETDSTTSGLEYGLITGNLSIC--GNVADNVFLP 65
            |.:.:...||...:...||                      .:|.|..:...|  |:||.:    
  Fly     6 GRMYYEVFCISAWICLMRP----------------------SFGSIIKDSVKCTEGSVAAD---- 44

  Fly    66 FVGDCNRYYLCRSGQAIELQCEWPYEFNANTQSCVHPGDADCLPTCE--AFNFSTFSYQRTCTRY 128
             :.||..|:.|...:.:.|.|.....|.|:.:.||......| ||..  .|:...|.....|..|
  Fly    45 -IDDCASYFQCIDDETVHLNCANGSYFEASNEICVVDEFGVC-PTSRRLCFDGDIFEDINDCMSY 107

  Fly   129 VLCYYGKPVLRQCQDGLQYN--------SATDRCDFPQNVDCVESE------------------- 166
            |.|..|..|.::|..|..:|        |.|..|..|:.: |:|.|                   
  Fly   108 VKCIRGDLVRQRCPAGSNFNVISKNCQMSRTGSCASPKEI-CLEGELQVDSEDCAGYLECLNGGL 171

  Fly   167 -----------------CSIYSNAY-----------HLRYVPSKVSCQKYFICGNGIPREQTCTA 203
                             |.:..|..           .:|..|:  :|..||.|.||....:||.:
  Fly   172 VKEKCPIGSYFEPIFKLCQLDENGVCSSSSSECTDGEVRVDPN--NCAGYFNCENGRLITKTCPS 234

  Fly   204 GLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYYYCVD 268
            |.:|......|.:..|..|..|..:....|| ::.|....|                  |..|:|
  Fly   235 GTYFEPTYKTCTVDLKGVCVEPPAKCTEGQL-KIDPNNCAG------------------YLKCID 280

  Fly   269 GHGLVLDCSAGLWYDPTVQEC 289
            |..:...|..|.:||..::.|
  Fly   281 GEFVEEKCPGGTYYDFKLETC 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 10/42 (24%)
CBM_14 111..161 CDD:279884 15/59 (25%)
CBM_14 178..222 CDD:279884 13/43 (30%)
CBM_14 246..295 CDD:279884 9/44 (20%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884 10/42 (24%)
ChtBD2 <212..245 CDD:214696 11/34 (32%)
CBM_14 267..308 CDD:279884 11/53 (21%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.