DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and Mur2B

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:236 Identity:51/236 - (21%)
Similarity:68/236 - (28%) Gaps:85/236 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DNVF--------------LPFVGDCNR--------------YYLCRSGQAIELQCEWPYEFNANT 96
            ||||              ..:...|:|              ||:|:....|..:|.....|||::
  Fly    66 DNVFGVFKSYPGGGFPVRFDYNNRCSRNYIGIKPHPDQQQYYYVCKPDCVIFSKCRGLESFNASS 130

  Fly    97 QSCV----------------------HPGDADCLPTCEAFNFSTFSYQRTCTRYVLCYYG---KP 136
            ..||                      ||.|......|:.        .||......|..|   .|
  Fly   131 GRCVQHVPQHRPDHRPPQCQKEGRFPHPHDCKVYYRCDK--------NRTQPWLFACPAGTIFSP 187

  Fly   137 VLRQCQDGLQYNSATDRCD----FPQNVDCVESECSIYSNAYHLRYVPSKVSCQKYFIC-----G 192
            |.|:|..|.|..| |:..|    .|||.:....||:....      ..|...|..|:.|     |
  Fly   188 VERKCLPGDQCPS-TEISDSGSYIPQNCELKFPECAEEGT------FRSPTDCALYYTCRLQESG 245

  Fly   193 NGIPREQTCTAGLHFSTKCDCCDIPSKSDC--------QIP 225
            ..:.....|.....|..:...|...|:.||        |:|
  Fly   246 TYLQTRFKCPGSNSFDLERKLCRPRSEVDCFDFVPGPVQVP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 16/92 (17%)
CBM_14 111..161 CDD:279884 17/56 (30%)
CBM_14 178..222 CDD:279884 9/48 (19%)
CBM_14 246..295 CDD:279884
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 12/47 (26%)
CBM_14 150..197 CDD:279884 13/54 (24%)
CBM_14 221..275 CDD:279884 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.