DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and R02F2.4

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:288 Identity:65/288 - (22%)
Similarity:95/288 - (32%) Gaps:72/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CGNVADNVFLPFVGDCN-RYYLCRSGQAIELQCEWPYEFNANTQSC------------------- 99
            |.||.|.:: | :|.|. |:..|.||:|..:.|.....::.|.:.|                   
 Worm    25 CTNVGDGMY-P-LGACEPRFLACVSGEARYMDCPEDLVYHKNLEFCDWRHNVFECGEEGEENEFS 87

  Fly   100 --------------------VHPGDADCLPTCEAFNFSTFSYQRTCTRYVLCYYGKPVLRQCQDG 144
                                ...||......||:.....:|.....:.|::|..|.|....|...
 Worm    88 GDGSGESSGDEEITFGDSSGESSGDELLENVCESLKDGVYSSGTCSSSYIICNSGSPRFLSCSTP 152

  Fly   145 LQYNSATDRCDFPQNVDCVESECSIYSNAY-----HLRYVPSKVSCQK-YFICGNGIPREQTCTA 203
            |.|:....:|.:...:|    |||..|..|     ::    ||..|.. :|.|..||...:.|.|
 Worm   153 LIYDPTNKKCSWKGMID----ECSQVSGEYCESDGNI----SKSECSNVFFSCSEGIAHRRNCPA 209

  Fly   204 GLHFSTKCDCCDIPSK-SDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYYYCV 267
            .|.|:.....||.|.. .||.  ....|.|....:....:.|.|..|             :..|.
 Worm   210 NLVFNPAISSCDWPKNVMDCS--EKSEKPQNCGEVDGYFSFGRCSSS-------------FSACT 259

  Fly   268 DGHGLVLDCSAGLWYDPTVQECREPQNV 295
            :|..:|:.|..||.:....|.|....||
 Worm   260 NGIPIVMFCPDGLMFSEKNQMCDYEWNV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 13/82 (16%)
CBM_14 111..161 CDD:279884 11/49 (22%)
CBM_14 178..222 CDD:279884 14/45 (31%)
CBM_14 246..295 CDD:279884 10/48 (21%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884 15/50 (30%)
ChtBD2 117..165 CDD:214696 11/47 (23%)
CBM_14 185..229 CDD:279884 14/47 (30%)
ChtBD2 240..283 CDD:214696 11/55 (20%)
CBM_14 310..361 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.