DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and LOC1270483

DIOPT Version :10

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_309183.3 Gene:LOC1270483 / 1270483 VectorBaseID:AGAMI1_001864 Length:248 Species:Anopheles gambiae


Alignment Length:237 Identity:60/237 - (25%)
Similarity:91/237 - (38%) Gaps:64/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ADCLPTCEA-------FNFS------TFSYQRTCTRYVLCYYGKPVLRQCQDGLQYNSAT---DR 153
            |..|..|.|       |.|:      .|.....|.:|..|..|:...:.|.|||.:|.|:   ::
Mosquito    14 AAVLTVCSAADEPEDYFEFTCPKPDGQFEDPYQCDKYYECNDGRVKEQLCPDGLVFNPASKLVNK 78

  Fly   154 CDFPQNVDCVESE----------CSIYSNAY-HLRYVPSKVSCQKYFICGNGIPREQTCTAGLHF 207
            ||...||||.:.:          |...:..: |    |....|..::.|.||...|.||.|||||
Mosquito    79 CDQVFNVDCGDRKELQPPRPIGVCPRQNGFFPH----PDSSICNIFYNCINGRELEMTCVAGLHF 139

  Fly   208 STKCDCC---DIPSKSDC------------QIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHE 257
            ......|   |:.::..|            |.|...:|:.:..::       |..|:    |.|.
Mosquito   140 YEPTGTCVWPDMANRQGCGSNANKKLNDGFQCPKNAQKMDKNGQI-------ITHPN----YPHP 193

  Fly   258 SRRDAYYYCVDG----HGLVLDCSAGLWYDPTVQECREPQNV 295
            .....:|.|::|    .|   .|..|:.|:..:|.|.:|:||
Mosquito   194 DDCQRFYICLNGIEPRQG---TCDQGMVYNEDLQRCDDPENV 232

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity