DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10140 and LOC110437948

DIOPT Version :9

Sequence 1:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:161 Identity:36/161 - (22%)
Similarity:52/161 - (32%) Gaps:52/161 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PVLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSNAYHLRYVPSKVSCQKYFICGNGIPREQT 200
            |.|..|.:..|....|::.:.|..:|.:..         |:        |.:...|..|..|...
Zfish     2 PRLNLCHNFTQRFYCTEKAESPTPIDGITG---------HV--------CPEGHYCPPGATRPVP 49

  Fly   201 CTAGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYYY 265
            |.:|. |.|      :|..|.|.............||       :||              |.:|
Zfish    50 CHSGT-FVT------VPQASQCWACTAGWYCADGGRL-------LCP--------------AGFY 86

  Fly   266 CVDGHGL-VLDCSAGLWYDP-----TVQECR 290
            |.:|.|. :..|.||. |.|     ::.|||
Zfish    87 CPEGTGYDIRPCPAGT-YSPDSGLISLSECR 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10140NP_648648.2 CBM_14 63..106 CDD:279884
CBM_14 111..161 CDD:279884 6/24 (25%)
CBM_14 178..222 CDD:279884 10/43 (23%)
CBM_14 246..295 CDD:279884 15/51 (29%)
LOC110437948XP_021322240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.