| Sequence 1: | NP_648647.1 | Gene: | CG10725 / 39510 | FlyBaseID: | FBgn0036362 | Length: | 269 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001237816.2 | Gene: | LOC4576210 / 4576210 | VectorBaseID: | AGAMI1_010698 | Length: | 373 | Species: | Anopheles gambiae |
| Alignment Length: | 38 | Identity: | 13/38 - (34%) |
|---|---|---|---|
| Similarity: | 19/38 - (50%) | Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 157 CDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKVNC 194 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10725 | NP_648647.1 | CBM_14 | <40..73 | CDD:426342 | |
| CBM_14 | 83..134 | CDD:426342 | |||
| CBM_14 | 150..192 | CDD:426342 | 12/34 (35%) | ||
| ChtBD2 | 216..264 | CDD:214696 | |||
| LOC4576210 | XP_001237816.2 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||