DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10725 and LOC4576210

DIOPT Version :10

Sequence 1:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_001237816.2 Gene:LOC4576210 / 4576210 VectorBaseID:AGAMI1_010698 Length:373 Species:Anopheles gambiae


Alignment Length:38 Identity:13/38 - (34%)
Similarity:19/38 - (50%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 CDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKVNC 194
            |.:||.|::|..:...|..||.:|...:.||..|...|
Mosquito   306 CSRYYGCLEGCVKEFKCPDGLYWNDQQKRCDSYSSSQC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10725NP_648647.1 CBM_14 <40..73 CDD:426342
CBM_14 83..134 CDD:426342
CBM_14 150..192 CDD:426342 12/34 (35%)
ChtBD2 216..264 CDD:214696
LOC4576210XP_001237816.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.