DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10725 and Mur89F

DIOPT Version :9

Sequence 1:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster


Alignment Length:194 Identity:48/194 - (24%)
Similarity:72/194 - (37%) Gaps:30/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SCKNRGLSSFCYDRT-CTKYVLCFDG-----TPVIRQCSDGLQYNALTDRCDYPQYV-DCVDNLC 139
            :||..|  .|..||: |.|:..|.|.     ..|...|..|..::|....|::...| :|.....
  Fly  1204 TCKVNG--QFIGDRSDCAKFYRCVDNDRGGFNMVPFSCGPGTVWDAQMQACNHAWAVKECGGIAP 1266

  Fly   140 SRNNNPDDIVFIPSKARCDKYYICMDGLPQVQNCTSGLQYNPSTQS--CDFPSKVNCTVESLQRN 202
            ...:.|  ....|:.|...:        |..|..||.....|:|..  ...|:..:.|..|..:.
  Fly  1267 PTTSTP--TTSRPTTASTSR--------PSDQTSTSRPTGPPTTARPVTARPTTSSPTTASSSQT 1321

  Fly   203 ILPFARAPPRLADIECPSEGAHFIAHQKRQDAYYYCL-NGRG----VTLDCTPGLVFDAKREEC 261
            ..|..:||.  .|.:|.|||  |:|.......:|.|: |.:|    :...|..|.|:|...:.|
  Fly  1322 TSPVTQAPN--TDGKCRSEG--FMADPNNCSKFYRCVRNNKGGFTSIPFQCGAGTVWDQDLQTC 1381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10725NP_648647.1 CBM_14 35..73 CDD:279884
CBM_14 83..134 CDD:279884 16/57 (28%)
CBM_14 150..192 CDD:279884 9/43 (21%)
ChtBD2 216..264 CDD:214696 15/51 (29%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884 15/56 (27%)
CBM_14 1336..1388 CDD:279884 14/48 (29%)
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.