DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10725 and CG34324

DIOPT Version :10

Sequence 1:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:118 Identity:29/118 - (24%)
Similarity:45/118 - (38%) Gaps:23/118 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CTKYVLCFDGTPVIRQCSDGLQYNALTDRCDYPQ------YVD------CVDN-------LCSRN 142
            ||:...|....|....|:  ......|..|..|:      .||      .:||       |.||:
  Fly   145 CTRTPPCTTTPPCTPPCT--TTKPCTTTVCTTPKSDNAGPIVDGNEEQPDIDNPVAIAQVLISRH 207

  Fly   143 N--NPDDIVFIPSKARCDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKVN 193
            :  ..:|..|:.....|.:||:|.....:.|||.:|..::...::|...|.||
  Fly   208 DCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10725NP_648647.1 CBM_14 <40..73 CDD:426342
CBM_14 83..134 CDD:426342 10/48 (21%)
CBM_14 150..192 CDD:426342 11/41 (27%)
ChtBD2 216..264 CDD:214696
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.