DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG42397

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:235 Identity:45/235 - (19%)
Similarity:75/235 - (31%) Gaps:85/235 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLLLLFIILMVHRNRADEDLVVAPGPDDDGEGLNVQDKDIYDMYENTQINVCGNVADGVYLPYVG 71
            |||.||.:|:             .|....||..|:                              
  Fly     8 GLLGLFALLV-------------SGSTSSGEDTNI------------------------------ 29

  Fly    72 NCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGYDPVLQVCTYMEEVQCLPTCESFRLS 136
               |....|:.|:::....|......|.:|                   .:|...||..:     
  Fly    30 ---KLTTDESTTVEDTTEVLVTTLPPPVLC-------------------ADEDLFLPAPD----- 67

  Fly   137 SFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSATFQP------EDI 195
                   |.:|..|.||:.:|:.|.|||.::...:.|.: :...| |:|.:.|..|      ..:
  Fly    68 -------CREYYQCLYGEGILKICPDGLYWDRELNVCAW-DSQHC-ADDKNETTTPSTLNCASGL 123

  Fly   196 IYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDF 235
            .:|.....|:|:..|.....::..|..||.:|...:.||:
  Fly   124 PFLPYIPDCTKFIQCVYNIGFKLSCPSGLYWNQPLQSCDY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 11/49 (22%)
CBM_14 197..239 CDD:279884 10/39 (26%)
ChtBD2 263..311 CDD:214696
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 14/56 (25%)
ChtBD2 125..163 CDD:214696 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.