DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and Gasp

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:208 Identity:56/208 - (26%)
Similarity:78/208 - (37%) Gaps:57/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 YDNTCTKYVLCYYGKPVLRQCHDGLQYNNA-----TDRCDFPEYVDC----------VANDCSAT 189
            :|.:|.||..|..|...|:.|.:||.::..     |:.||:...|||          ....||..
  Fly    32 HDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRL 96

  Fly   190 FQ--PEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFAKNV-NCTIDAVARNIL 251
            :.  |::       ..|..::.|.||.|...||:|||||:...:.|.:|..| .|..:.||..  
  Fly    97 YGIFPDE-------NKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANG-- 152

  Fly   252 PYSRTPLRRADIKCPLMG---------THFFPHKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVED 307
                       ..||..|         .|..|...|:  ||.|:||......|..|..:  |:.|
  Fly   153 -----------FSCPAAGELANAGSFSRHAHPEDCRK--YYICLEGVAREYGCPIGTVF--KIGD 202

  Fly   308 ------CRRPEFV 314
                  |..||.|
  Fly   203 SDGTGNCEDPEDV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 13/44 (30%)
CBM_14 197..239 CDD:279884 14/41 (34%)
ChtBD2 263..311 CDD:214696 16/62 (26%)
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 12/39 (31%)
CBM_14 97..144 CDD:366726 16/53 (30%)
CBM_14 170..218 CDD:366726 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.