DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG7017

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster


Alignment Length:327 Identity:72/327 - (22%)
Similarity:115/327 - (35%) Gaps:91/327 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ADEDLVVAPGPDDDGEGLNVQDKDIYDMYENTQINVCGNVADGVYL--PYVGNCSKYIECENNTI 84
            |.....|.|..|      ::.||         ..|:|.|..:|.::  |...:|..||.|:::  
  Fly    82 ASSSAAVCPYAD------SIADK---------ATNLCANETEGAFIVDPSSSDCRGYILCKSH-- 129

  Fly    85 KEV-GSCLDLAKDNPDICDPNKSCELGYDPVLQVCTYMEEVQCLPTCESFRLSSFCY---DNT-- 143
            |:: .:|            ||   ||.:.||.:.|.|.::.:| |..::.:.|..|.   :||  
  Fly   130 KQIKANC------------PN---ELIFHPVSRSCVYEKQYRC-PISQTKKTSPACRSLPNNTRL 178

  Fly   144 -----CTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSATFQPED--------- 194
                 |.:|..|.......|.|.....|:.....|.....|.|.  :.:|..:||:         
  Fly   179 ADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCY--ESAALPEPENTFCLDSATG 241

  Fly   195 ---IIYLGSKASCSKYYVCS-------NGHPWEQQCAPGLAYNPSCKCCDFAKNVNCTIDAVARN 249
               :.|.....|||.||:|.       :..|....|..|..::.....|....||.|.:|     
  Fly   242 SARVGYFADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDFEKLSCRDRLNVRCQLD----- 301

  Fly   250 ILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYY--CVEGRGVTL-DCTPGLYYDPKVEDCRRP 311
                          :|  :||:........|...|  |..|..|:| .|..|.|:|.:.:.|.:.
  Fly   302 --------------RC--VGTNITYVNVAGDCQSYGRCSGGVTVSLGQCPTGYYFDERNQGCTQT 350

  Fly   312 EF 313
            .:
  Fly   351 NY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 11/59 (19%)
CBM_14 197..239 CDD:279884 11/48 (23%)
ChtBD2 263..311 CDD:214696 14/50 (28%)
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 18/68 (26%)
ChtBD2 246..290 CDD:214696 10/43 (23%)
CBM_14 303..348 CDD:279884 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.