DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG6996

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:267 Identity:64/267 - (23%)
Similarity:100/267 - (37%) Gaps:64/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VCGNVADGVYLPYVGNCSKYIEC-ENNTIKEVGSCLDLAKDNPDICDPNKSCELGYDPVLQVCTY 120
            :|..|.:|..:.....|:.:|:| :.:.:.  |||               :..|.||...|.|..
  Fly    28 ICSLVVNGTKMNDPRACNAWIQCIDGSPVS--GSC---------------ATGLFYDRESQKCLS 75

  Fly   121 MEEVQCLPT--CESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRC--DFPEYVDC 181
            ...::||.:  |.:..........:|..|..|..||.....|:.|:.:|:.|..|  |||     
  Fly    76 SSSIKCLSSDPCAALPTGFAADPYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFP----- 135

  Fly   182 VANDCSATFQPE-------DIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAY-NPSCKCCDFAKN 238
                ||....|:       |.:::....:|:.|.:|.:|......| ||..| ..|...||:.:|
  Fly   136 ----CSNKMDPDSYCNILPDGVFVKDTDNCNGYQLCWDGQVINGTC-PGTFYFKASTAQCDYPQN 195

  Fly   239 VNCTIDAVARNILPYSRTPLRRADIK----CPLMGTHFFPHKSRRDAYYYCVE-GRG-VTLD--- 294
            |.|....|              .||.    ||..| .|.......:.||||.: |.| .:|:   
  Fly   196 VECDFVPV--------------PDISKKGVCPETG-GFISDNKTCNGYYYCKDLGNGEFSLEHGV 245

  Fly   295 CTPGLYY 301
            |:.|.::
  Fly   246 CSDGRFF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 14/51 (27%)
CBM_14 197..239 CDD:279884 11/42 (26%)
ChtBD2 263..311 CDD:214696 14/48 (29%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 13/60 (22%)
ChtBD2 85..130 CDD:214696 10/44 (23%)
CBM_14 146..196 CDD:279884 12/50 (24%)
CBM_14 273..322 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.