DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG7290

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:282 Identity:62/282 - (21%)
Similarity:91/282 - (32%) Gaps:64/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 INV---CGNVADGVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGY--DPV 114
            :||   |..|::|.|:....:||.|.:|:.::...:                  ||..||  |..
  Fly    26 VNVTALCLLVSNGNYVASQSDCSTYYQCQGSSFTAM------------------SCPQGYYFDKN 72

  Fly   115 LQVCTYMEEVQCLPTCE--------SFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATD 171
            .|.||......|....:        ||..||    ::|..|..|.....|...|..|..:|..|.
  Fly    73 AQQCTGTVPSTCTSNSDPCLGKAVGSFAASS----SSCGGYYYCGASGAVRGNCPAGENFNPTTM 133

  Fly   172 RCDFPEYVDC------------VANDCSATFQPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGL 224
            .|.:.....|            ..|.|:..   ::..|.||.:.||.:..|.:.......|..||
  Fly   134 ACVYKNNYPCSESAGDGSTVSVALNLCNLV---KNGFYFGSPSDCSGWNFCQDNVLHSGSCEDGL 195

  Fly   225 AYNPSCKCCDFAKNVNC---TIDAVARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYYCV 286
            .:|.....|.:....:|   |.|.....:         .|...|...|...  ..:..:.||.|.
  Fly   196 VFNVQASNCGYKMASSCAQVTNDPSLTGV---------SAPTTCSSSGATI--AATACNQYYLCS 249

  Fly   287 EGRGVTLDCTPGLYYDPKVEDC 308
            .|....:.|..|.|||...:.|
  Fly   250 AGNYQLMTCPSGYYYDTISKAC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 13/57 (23%)
CBM_14 197..239 CDD:279884 11/41 (27%)
ChtBD2 263..311 CDD:214696 12/46 (26%)
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884 14/62 (23%)
CBM_14 91..142 CDD:279884 13/54 (24%)
CBM_14 160..207 CDD:279884 12/49 (24%)
CBM_14 234..277 CDD:279884 11/40 (28%)
ChtBD2 <296..331 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.