DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG7298

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster


Alignment Length:344 Identity:79/344 - (22%)
Similarity:111/344 - (32%) Gaps:111/344 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LNGLLLLFIILMVHRNRADEDLVVAPGPDDDGEGLNVQDKDIYDMYENTQIN-VCGNVADGVYLP 68
            :.|.|||..||.:...:|..|.::        ||             |..:. ||..|..|..|.
  Fly     1 MTGKLLLATILCLMGGQALGDAIL--------EG-------------NYNVTAVCTAVKVGTQLG 44

  Fly    69 YVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELG--YDPVLQVCTYMEEVQCLPTCE 131
            .:.:|..|..|::.              .|    ...||:.|  ||.....|....||.|.    
  Fly    45 SIESCQTYYVCQST--------------GP----VQSSCQSGYSYDYKRSSCYPSSEVDCY---- 87

  Fly   132 SFRLSSFC--YDNT-------CTKYVLCYYGKPV-LRQCHDGLQYNNATDRCDFPEYVDCVANDC 186
             :.:.:.|  .:||       |..:..|..||.. ...|....:::..|        :.||...|
  Fly    88 -WGVENPCAGKNNTWVPNTAVCGGWFYCLEGKSAGSGNCPVNQKFDTTT--------LACVYGTC 143

  Fly   187 SATFQPEDII------------YLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCC---DFA 236
            |.|....:.:            |.|...|||.::.|       :..:.||... |.||.   ..|
  Fly   144 SNTQGTNETVLESLCDVVPPGQYFGDTESCSTWHYC-------ESTSTGLVLQ-SGKCSANNQTA 200

  Fly   237 KNV---NCTIDAVA-----RNILPYSRTPLRRADIKCPLMGTHFFPHKSRR----DAYYYCVEGR 289
            .||   .||.::.:     .||      ||..|.:.|...|.     ||..    ..||.|..|:
  Fly   201 YNVLANQCTYESASVCSRVTNI------PLSDAAVSCSTNGA-----KSADPKVCGTYYVCTNGK 254

  Fly   290 GVTLDCTPGLYYDPKVEDC 308
            .|...|..|.|||..:..|
  Fly   255 NVATYCPTGDYYDDSLGYC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 9/59 (15%)
CBM_14 197..239 CDD:279884 12/44 (27%)
ChtBD2 263..311 CDD:214696 15/50 (30%)
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 11/35 (31%)
ChtBD2 286..334 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.