DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and obst-F

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:314 Identity:62/314 - (19%)
Similarity:88/314 - (28%) Gaps:113/314 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 CELGYDPVLQVCTYM------EEVQCLPTCESF--RLSSFC----------YDNTCTKYVLCYYG 153
            |...|...|.:|..:      ::...||.....  .||..|          :...|..|..| ..
  Fly     3 CSWAYVLALSICFQLGAGHAVDQSWELPKVRHTVGHLSHICLGRQEGDLVPHPLDCNGYFSC-SR 66

  Fly   154 KPVLRQCHDGLQYNNATDRCDFPEYVDC-------------------------------VANDCS 187
            .|.|..|..|||::.....||.||..:|                               ||.|.:
  Fly    67 VPTLLYCDQGLQFDENRAICDLPENTNCRPVATGTVESANGLADNSELNWWPHKPKPVFVAVDVT 131

  Fly   188 A--------TFQPEDI-------IYLGSKASCSKYYVCSNGHPWEQQCAPGLAYN---PSCKCCD 234
            :        .:.||.|       .:|....:|..|::|:.||....||..|.|:|   ..|:..|
  Fly   132 SGQPVNPMEKYDPEHIECRHYGAYFLPHPRNCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSD 196

  Fly   235 FA------------KNVNCTIDAVARN---------------------------------ILPYS 254
            .|            .:|..|:.....|                                 :.|.|
  Fly   197 QAICYGESQISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEITELPPVTPPS 261

  Fly   255 RTPLRRADIKCPLMGTHFFPHKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVEDC 308
            ........:.||.....:..|......||.|:.|..|...|..||::|.|...|
  Fly   262 PPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 16/61 (26%)
CBM_14 197..239 CDD:279884 14/56 (25%)
ChtBD2 263..311 CDD:214696 14/46 (30%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 14/51 (27%)
CBM_14 156..198 CDD:279884 13/41 (32%)
CBM_14 272..321 CDD:279884 14/44 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444036
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27026
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.