DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and obst-J

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster


Alignment Length:268 Identity:60/268 - (22%)
Similarity:95/268 - (35%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ENTQINVCGNVAD-GVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGYDPV 114
            |.|.|:....::| ...||:..:|.::..|..:             |:....:.|...|..:...
  Fly    22 ELTDISAICRISDPWQMLPHKDHCQRFYVCTGD-------------DDMPFQEFNCPAEYHFSKK 73

  Fly   115 LQVCT----YMEEVQCLPTCESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDF 175
            |.:|.    ..|.|.|..|....|:.|     .||:|          |||.:|..:  |..:|..
  Fly    74 LMICVPGACTDESVFCGLTNSVERVQS-----DCTRY----------RQCLEGGSF--AVAKCSV 121

  Fly   176 PEYVD-----CV------ANDCSATFQPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPS 229
            ..|.|     |:      |:.||...  .|...|.:.:.|..|:.|.:|.....||..|..::..
  Fly   122 GNYFDPARRACLPVAISAAHQCSCVL--PDNATLANPSDCETYFRCHSGQAELVQCPSGDYFDER 184

  Fly   230 CKCCDFAKNVNCTIDAVARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYYCVEGRGVTLD 294
            ...|.......|    :.:..:|.:.|....|..:|...|:...||......||.|.:.|.:.:.
  Fly   185 VSSCVPDHTGIC----LEKPTMPPTLTEQALAMDECIRTGSRLAPHSRDCQRYYICAKKRVLEMR 245

  Fly   295 CTPGLYYD 302
            |..|.|:|
  Fly   246 CPRGQYFD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 12/49 (24%)
CBM_14 197..239 CDD:279884 9/41 (22%)
ChtBD2 263..311 CDD:214696 12/40 (30%)
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 8/51 (16%)
CBM_14 145..192 CDD:279884 10/48 (21%)
CBM_14 216..259 CDD:279884 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.