DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG10725

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:263 Identity:139/263 - (52%)
Similarity:175/263 - (66%) Gaps:20/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 INVCGNVADGVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGY--DPVLQV 117
            :|||.||.:.:::|.|||||||..|.|                 :|..| :.|...|  |...|.
  Fly    24 VNVCSNVVNNLFVPQVGNCSKYFLCMN-----------------EIAVP-RECPTDYYFDARDQE 70

  Fly   118 CTYMEEVQCLPTCESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCV 182
            |..:.||:|:.:|::..|||||||.||||||||:.|.||:|||.||||||..|||||:|:|||||
  Fly    71 CVPLMEVECIGSCKNRGLSSFCYDRTCTKYVLCFDGTPVIRQCSDGLQYNALTDRCDYPQYVDCV 135

  Fly   183 ANDCSATFQPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFAKNVNCTIDAVA 247
            .|.||....|:||:::.|||.|.|||:|.:|.|..|.|..||.||||.:.|||...||||::::.
  Fly   136 DNLCSRNNNPDDIVFIPSKARCDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKVNCTVESLQ 200

  Fly   248 RNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVEDCRRPE 312
            |||||::|.|.|.|||:||..|.||..|:.|:||||||:.||||||||||||.:|.|.|:||.|.
  Fly   201 RNILPFARAPPRLADIECPSEGAHFIAHQKRQDAYYYCLNGRGVTLDCTPGLVFDAKREECREPH 265

  Fly   313 FVG 315
            .||
  Fly   266 LVG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 35/49 (71%)
CBM_14 197..239 CDD:279884 21/41 (51%)
ChtBD2 263..311 CDD:214696 31/47 (66%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 17/55 (31%)
CBM_14 83..134 CDD:279884 36/50 (72%)
CBM_14 150..192 CDD:279884 21/41 (51%)
ChtBD2 216..264 CDD:214696 31/47 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466378
Domainoid 1 1.000 50 1.000 Domainoid score I18826
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I7014
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 1 1.000 - - FOG0012676
OrthoInspector 1 1.000 - - mtm9695
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.