DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG7248

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:245 Identity:66/245 - (26%)
Similarity:91/245 - (37%) Gaps:42/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NNTIKEVGSCLDLAKDNPDICDPNKSCELGYDPVLQVCTYMEEVQCLPTCESFRLSSFCYDNTCT 145
            ||..:.|  .|..:|.|...|..:..         |..||         |||.....:.|...|:
  Fly    33 NNVNQNV--ILSFSKRNSHECVVSSQ---------QNSTY---------CESLSNGFYEYPYNCS 77

  Fly   146 KYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDC--------------VANDCSATFQPEDII 196
            .|:.||.....|..|.||..:|:....||.|..|||              ..|.|..|   .:..
  Fly    78 AYITCYDSCADLEYCPDGKLFNSPLQICDTPGAVDCEPLPYPTPSPTESPPENPCLGT---RNNT 139

  Fly   197 YLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFAKNVNCTIDAVARNILPYSRTPLRRA 261
            .|.|..:|:::|:|.|......:|...:.:||....||...||.|..|....:.|. :.||...:
  Fly   140 LLPSAENCNEFYLCVNDQSKVYRCPGEMLFNPDLNICDDKDNVWCYGDRTTPDPLD-TTTPAEES 203

  Fly   262 DIKC--PLMGTHFFPHKSRRDAYYYCVEGRGVT-LDCTPGLYYDPKVEDC 308
            ..||  ...|| |||.......||||...:..| |.|....:::|...:|
  Fly   204 FTKCEDQEKGT-FFPDPENCQQYYYCWGNKSYTILPCPVDNWFNPISGNC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 16/49 (33%)
CBM_14 197..239 CDD:279884 11/41 (27%)
ChtBD2 263..311 CDD:214696 16/49 (33%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 17/50 (34%)
CBM_14 136..182 CDD:279884 11/45 (24%)
CBM_14 207..261 CDD:279884 15/47 (32%)
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444046
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.