DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG17826

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster


Alignment Length:391 Identity:93/391 - (23%)
Similarity:136/391 - (34%) Gaps:144/391 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DDDGEGLNVQD---KDIYD--MYE------------------NTQINVC--------GN---VAD 63
            ||:|..:|.::   |.:.|  |||                  |:|..||        ||   ..|
  Fly   394 DDEGICVNCKEGSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVDNGQCNGNGTTCTD 458

  Fly    64 GVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELG--YDPVLQVCTYMEEVQC 126
            |.......||:.|:.|.|      |:.:            :|.|..|  ::..|:.|...:|..|
  Fly   459 GELKVDPTNCAGYLACSN------GNWV------------SKQCADGAYFNATLETCVQDDEGIC 505

  Fly   127 LPTCESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPE-------------- 177
            : .|:........   .||.|.:|..||.|.:.|..|..:|:.::.||...              
  Fly   506 V-NCKEGSTKPLA---DCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVDNGQCNGNGTTCTENE 566

  Fly   178 ----------YVDC-----VANDCSAT--FQ--------------------------PEDIIYLG 199
                      |:.|     ||..||||  |.                          |.:.|:..
  Fly   567 VKVNPADCAGYLQCINGVFVARKCSATQFFNTTLKECEVDTENVCIPKTCDPDCCDVPNNSIWPV 631

  Fly   200 SKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFAKNVNCTIDAVARNILPYSRTPLRRADIK 264
            .| :||.:|.|.||:.:||:|:..|.||...:.||:.:||.|. |..|    |.|      ..|.
  Fly   632 EK-NCSAFYQCVNGNKYEQRCSNNLQYNSIIEQCDYPENVQCD-DGSA----PPS------GPIA 684

  Fly   265 CPLMGTHFFPH---KSRRDA-------------YYYCVEGRGVTLDCTPGLYYDPKVEDCRRPEF 313
            .| .||:...|   ..:||.             |..|.....|...|:.||.::.:|:.|..|:.
  Fly   685 GP-SGTYCESHGRCVGQRDGTMFADASGDCSSNYVVCQCECEVNFTCSSGLLFNLQVKSCDWPDN 748

  Fly   314 V 314
            |
  Fly   749 V 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 14/73 (19%)
CBM_14 197..239 CDD:279884 15/41 (37%)
ChtBD2 263..311 CDD:214696 15/63 (24%)
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884
CBM_14 251..290 CDD:279884
CBM_14 357..396 CDD:279884 1/1 (100%)
CBM_14 463..502 CDD:279884 11/56 (20%)
CBM_14 563..610 CDD:279884 9/46 (20%)
CBM_14 621..670 CDD:279884 17/49 (35%)
CBM_14 697..749 CDD:279884 11/51 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.