DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG5883

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:382 Identity:85/382 - (22%)
Similarity:126/382 - (32%) Gaps:117/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKWLLNGLLL--LFIILMVHRNRADEDLVVAPGPDDDGEGLNVQDKDIYDMYENTQINVCGNVAD 63
            |:.|.:.|:|  |.:.:|||::                         |...|.|...::|....|
  Fly     1 MRGLPSSLVLQALLLAVMVHQS-------------------------IQTRYLNATDDICRLFKD 40

  Fly    64 GVYLPYVGNCSKYIECEN--NT------------IKEVGSC---LDLAKDNPDICDPN------- 104
            |..|...|:||:.|.|:|  :|            .|..|||   .|...|...||..:       
  Fly    41 GTQLLKPGSCSESIICQNFESTPGITCSGSKPYYSKSKGSCQASADTYCDTSKICKGSGTGYIGD 105

  Fly   105 ------------------KSCELG--YDPVLQVCTYMEEVQCLPTCESFRL----SSFCYDNTCT 145
                              .:|.||  :|.|.:.|.|.|:..|....|...:    :.|..|..|.
  Fly   106 TINCANWYYCDADALLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDANCH 170

  Fly   146 KYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVDCVANDCSATFQPEDII----------YLGS 200
            ||..|.....|...|.:||.||.||..|...:.|.|..:..     |:::.          ::..
  Fly   171 KYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPL-----PDEVCGNKKLAVRNKFVSD 230

  Fly   201 KASCSKYYVC-------SNGHPWEQQCAPGLAYNPSCKCCDFAKNVNCTIDAVARNILPYSRTPL 258
            .|:|..||.|       .:..|..|||.....:|...:.|...::..|          .|.|...
  Fly   231 MATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKC----------DYDRCDG 285

  Fly   259 RRADIK-CPLMGTHFFPHKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVEDCRRPEFV 314
            |:...: ..:.|.|.         |..||:||..|.......|:|...::|.....|
  Fly   286 RKDGFEVAEIDGCHH---------YIECVDGRETTPISCEDKYFDVVTQNCSSTHLV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 16/53 (30%)
CBM_14 197..239 CDD:279884 11/48 (23%)
ChtBD2 263..311 CDD:214696 11/48 (23%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 9/50 (18%)
CBM_14 154..204 CDD:279884 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.