DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG33986

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:219 Identity:53/219 - (24%)
Similarity:82/219 - (37%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CESFRLSSFC-YDNTCTKYVLCY-YGKPVLRQCHDGLQYNNATDRCDFPEYVDC----------- 181
            |.:..:..|. :...|..:.||. .|..||..|...:.:|:.:..||....|.|           
  Fly    41 CANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKCRNETDPIETPP 105

  Fly   182 ----------------VANDCSATFQPED----IIYLGSKASCSKYYVCSNGHPWEQQCAPGLAY 226
                            .|..||...:.:.    |:|:||.:||.|||:|..|....|:|:..|.:
  Fly   106 FDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCRKYYICYYGQAILQECSSQLHW 170

  Fly   227 NPSCKCCDFAKNVNCTIDAV------ARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYYC 285
            |.....||..:...||:...      ..:..|...|.:....|.||..|.|.:||..|.:.:.||
  Fly   171 NAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLIHCPAYGQHLYPHMQRCEFFIYC 235

  Fly   286 VEGRGVTLDCTPGLYYDPKVEDCR 309
            |:|......|....::|...:.|:
  Fly   236 VKGHASLQQCPFYYFFDIATKSCQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 12/51 (24%)
CBM_14 197..239 CDD:279884 16/41 (39%)
ChtBD2 263..311 CDD:214696 15/47 (32%)
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 12/50 (24%)
CBM_14 141..185 CDD:279884 16/43 (37%)
ChtBD2 213..261 CDD:214696 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.