DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG4835

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:390 Identity:89/390 - (22%)
Similarity:130/390 - (33%) Gaps:151/390 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VHRNRADEDLVVAPG-PDDDGEGLNVQDKDIYDMYENTQINVCGNVADGVYLPYVGNCSKYIECE 80
            :|.:..:|.:....| |.|                  ...|.|.:..||....|:||||:|:.|:
  Fly   369 IHSSTTEEIVTTTDGLPSD------------------VDPNDCKDEKDGTIFAYIGNCSEYLICK 415

  Fly    81 NNTIKEVGSCLDLAKDNPDICDPNKSCELGYDPVLQVCTYMEEVQCL------------------ 127
            :|.: ::|.           |.||..    ::|.|.||...::|.||                  
  Fly   416 DNQV-QMGH-----------CPPNTL----FNPDLLVCDEPDDVVCLGDRTTTPIPTTIPTTTTE 464

  Fly   128 ---PT---------------CESFRL-SSFCYDNTCTKYVLCY-YGKPVLRQCHDGLQYNNATDR 172
               ||               |:...| :||.|.:.|:||.||. .|:..|..|..|..::.:|.:
  Fly   465 KTTPTTTTTTVATTLGPDQLCDGQELGASFSYPDDCSKYYLCLGGGQWTLAPCIYGSYFDPSTGQ 529

  Fly   173 CDFPEYVDCVAND-----------------------------------------------CSATF 190
            |. |:    ||.|                                               |....
  Fly   530 CG-PD----VAPDACKPSQVTTTTTTTTTETTTTERNTTPKSTATTTERTTTTVAPKTGICGGRN 589

  Fly   191 QPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSC-KCCDFAKNVNCTIDAVARNILP-Y 253
            :.|:|.|   ..:|:||.||.:..|....|..|..::... ||.|.....:|..|.....:.| |
  Fly   590 ENENIAY---PNNCTKYIVCVSPIPIAFFCPDGTFFSSKLEKCIDDWDESDCEGDQSTTTLEPGY 651

  Fly   254 SRTPLRRADIKCPLMGTHFFPHKSRRDAYYY---------CVEGRGVTLD-CTPGLYYDPKVEDC 308
            :|.|..      |.|.|:     |.||.:.|         ||:.....:| |..|.||||..|.|
  Fly   652 TRPPPE------PTMCTN-----SSRDTFPYPDNCQWFIRCVDDYIYMMDVCNCGEYYDPITEKC 705

  Fly   309  308
              Fly   706  705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 17/51 (33%)
CBM_14 197..239 CDD:279884 12/42 (29%)
ChtBD2 263..311 CDD:214696 18/56 (32%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 19/66 (29%)
CBM_14 485..539 CDD:279884 20/58 (34%)
CBM_14 585..638 CDD:279884 15/55 (27%)
CBM_14 661..714 CDD:279884 16/50 (32%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.