DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and CG32302

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:262 Identity:63/262 - (24%)
Similarity:92/262 - (35%) Gaps:72/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AKDNP--DICDPNKSC----ELGY--------------------------DPVLQVCTYMEEVQC 126
            |.|||  |:..|...|    .|||                          |.....||:..:.| 
  Fly    21 ANDNPCQDVRIPGFVCMNCTTLGYCIRDATGSWETISMLGCQSEYNFYCSDEGTFGCTFQSQCQ- 84

  Fly   127 LP-----TCESFRLSSFCYDNTCTKYVLCY-YGKPVLRQCHDGLQYNNATDRCDFP-EYVDCVAN 184
            :|     :|:...|....||  |.:|..|. ......|.|.:|..|:..|..|..| |...|:..
  Fly    85 VPKRGPFSCQQAGLFPDPYD--CRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQE 147

  Fly   185 D--CSATFQPEDIIYLGSKASCSKY-YVCSNG-----HPWEQQCAPGLAYNPSCKCCDFAKNVNC 241
            .  ||.:.|      :|..|..::| |||.|.     :|...:|..|..:| |..|....:::. 
  Fly   148 QFTCSRSGQ------VGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFN-SYSCVPDTRSMR- 204

  Fly   242 TIDAVARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVE 306
            :|.|:.      |.|.:.....:||.        ::....|..||:|....:.|..|...|||:.
  Fly   205 SIQAME------SHTCMNNDRYQCPF--------RTSEIEYCKCVDGELEVMTCPAGFQIDPKIL 255

  Fly   307 DC 308
            .|
  Fly   256 TC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 15/51 (29%)
CBM_14 197..239 CDD:279884 13/47 (28%)
ChtBD2 263..311 CDD:214696 12/46 (26%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.