DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10154 and obst-B

DIOPT Version :9

Sequence 1:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:136 Identity:39/136 - (28%)
Similarity:62/136 - (45%) Gaps:27/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 PEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYN---PSCKCCDFAKNVNCTIDAVARNILPY 253
            ||...:......|.|||.|.:|.|.|:.||.|:.:|   |..:.||...|::|            
  Fly    87 PEPNGFYPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDC------------ 139

  Fly   254 SRTPLRRADIKCPLMGTH------FFPHKSRR--DAYYYCVEGRGVTLDCTPGLYYDPKVEDCRR 310
                ::|:.::.|....|      :|.|:...  |.:|:||:|:...:.|..||.::||...|..
  Fly   140 ----MKRSKLQTPQPSLHCPRKNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVFNPKTGICGW 200

  Fly   311 PEFVGV 316
            |:.|||
  Fly   201 PDQVGV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884
CBM_14 197..239 CDD:279884 15/44 (34%)
ChtBD2 263..311 CDD:214696 15/55 (27%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 16/49 (33%)
CBM_14 156..204 CDD:279884 14/47 (30%)
CBM_14 233..278 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.